PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D07G1429
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 319aa    MW: 35424.2 Da    PI: 8.4915
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D07G1429genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.63.2e-091442129
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIar 29
                     +g+W +eEde+l+++++++G g+W++ ++
      Gh_D07G1429 14 KGPWGPEEDEILINYINKHGHGSWRSLPK 42
                     79***********************9877 PP

2Myb_DNA-binding48.81.6e-1591136148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +E++l +++++ lG++ W++Ia+ ++ gRt++++k+ w+++l
      Gh_D07G1429  91 RGPFTLDEEKLVIQLHAILGNR-WAAIASQLP-GRTDNEIKNLWNTHL 136
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-23588IPR009057Homeodomain-like
PROSITE profilePS5129410.073985IPR017930Myb domain
SuperFamilySSF466891.0E-7943IPR009057Homeodomain-like
SMARTSM007178.6E-101387IPR001005SANT/Myb domain
PfamPF002492.2E-71442IPR001005SANT/Myb domain
CDDcd001673.40E-71685No hitNo description
SuperFamilySSF466898.98E-2271142IPR009057Homeodomain-like
PROSITE profilePS5129424.50686140IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.5E-2589140IPR009057Homeodomain-like
SMARTSM007172.0E-1490138IPR001005SANT/Myb domain
PfamPF002491.7E-1491136IPR001005SANT/Myb domain
CDDcd001674.40E-1193136No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MGRRPCCERK GLKKGPWGPE EDEILINYIN KHGHGSWRSL PKLSALWKFL FCRVSPLQPI  60
KGLISTLTGL SRCGKSCRLR WTNYLRPDIK RGPFTLDEEK LVIQLHAILG NRWAAIASQL  120
PGRTDNEIKN LWNTHLKKRL LCMGVDPLTH EPFTSGGPTT RPRSSPATRH MAQWESARLE  180
AEARLSKESL FFNSPPTSVK PDPDFFLRLW NSEVGESFRK LNGEAKADCR SPISQASSST  240
KCGSVSGVTI DVGPIAAGSS TPKSSRTEDP IMFDASFSSS SNESEDSSDT ALQLLLDFPI  300
NNDMSFLDDV DTYATPPQC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-25121405108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4591691e-67AJ459169.1 Gossypium hirsutum partial myb139 gene, clone pGhMYB139.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012482512.10.0PREDICTED: myb-related protein 308-like
TrEMBLA0A0D2NAE80.0A0A0D2NAE8_G
STRINGPOPTR_0014s07700.11e-138(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69822643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.11e-115myb domain protein 17